General Information

  • ID:  hor003085
  • Uniprot ID:  H9KRP4(85-106)
  • Protein name:  Short neuropeptide F
  • Gene name:  100576163
  • Organism:  Apis mellifera (Honeybee)
  • Family:  NPY family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  NA

Sequence Information

  • Sequence:  SDPHLSILSKPMSAIPSYKFDD
  • Length:  22(85-106)
  • Propeptide:  MPIKFYLKSILLFIIVGFVVGTENYIDYSDEIPEKMPIENIQELYRLLMQRNALENARLGETPFEHLMIRKSQRSPSLRLRFGRSDPHLSILSKPMSAIPSYKFDDK
  • Signal peptide:  MPIKFYLKSILLFIIVGFVVG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-H9KRP4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003085_AF2.pdbhor003085_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 282352 Formula: C110H170N26O35S
Absent amino acids: CEGNQRTVW Common amino acids: S
pI: 5.49 Basic residues: 3
Polar residues: 6 Hydrophobic residues: 6
Hydrophobicity: -38.64 Boman Index: -3224
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 75.45
Instability Index: 4447.27 Extinction Coefficient cystines: 1490
Absorbance 280nm: 70.95

Literature

  • PubMed ID:  19576913
  • Title:  Mass Spectrometric Profiling of (Neuro)-Peptides in the Worker Honeybee, Apis Mellifera